Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Eda Peptide - C-terminal region

Eda Peptide - C-terminal region

Product Specifications

Product Name Alternative

RGD1563178

Field of Research

Stem Cell & Developmental Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Eda Rabbit Polyclonal Antibody (orb579205) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

XP_002727621

Preservative

Lyophilized powder

AA Sequence

FASYEVVVDEKPFLQCTRSIETGKTNYNTCYTAGVCLLKARQKIAVKMVH

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rspo1 Rat Pre-designed siRNA Set A
HY-RS23127 1 Set

Rspo1 Rat Pre-designed siRNA Set A

Sign In for Pricing
View Details
CDH3 (Cadherin-3, Cadherin 3, Type 1, P-Cadherin (Placental) )
477631 100 µL

CDH3 (Cadherin-3, Cadherin 3, Type 1, P-Cadherin (Placental) )

Sign In for Pricing
View Details
Rabbit Anti-Human IgG+IgM+IgA Antibody (AcalephFluor350)
orb2990622-01 100 µL

Rabbit Anti-Human IgG+IgM+IgA Antibody (AcalephFluor350)

Sign In for Pricing
View Details
Rabbit Anti-Human IgG+IgM+IgA Antibody (AcalephFluor350)
orb2990622-02 500 µL

Rabbit Anti-Human IgG+IgM+IgA Antibody (AcalephFluor350)

Sign In for Pricing
View Details
Rabbit Anti-Human IgG+IgM+IgA Antibody (AcalephFluor350)
orb2990622-03 1 mL

Rabbit Anti-Human IgG+IgM+IgA Antibody (AcalephFluor350)

Sign In for Pricing
View Details
FBXL8 (FBL8, F-box/LRR-repeat Protein 8, F-box and Leucine-rich Repeat Protein 8, F-box Protein FBL8, FLJ11278, MGC19959)
126669 100 µg

FBXL8 (FBL8, F-box/LRR-repeat Protein 8, F-box and Leucine-rich Repeat Protein 8, F-box Protein FBL8, FLJ11278, MGC19959)

Sign In for Pricing
View Details