Eda Peptide - C-terminal region
Eda Peptide - C-terminal region
Product Specifications
Product Name Alternative
RGD1563178
Field of Research
Stem Cell & Developmental Biology
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with Eda Rabbit Polyclonal Antibody (orb579205) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
XP_002727621
Preservative
Lyophilized powder
AA Sequence
FASYEVVVDEKPFLQCTRSIETGKTNYNTCYTAGVCLLKARQKIAVKMVH
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
207711-FITC 100 µL
HOXD11 (Homeobox D11, Hox-4.6, mouse, Homolog of, Homeo box 4F, Homeo box D11, Homeobox Protein Hox-D11, HOX4, HOX4F) (FITC)
Sign In for Pricing
View Details 
