Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Ctns Peptide - middle region

Ctns Peptide - middle region

Product Specifications

Product Name Alternative

AI195360, AW049661

UniProt

P57757

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Ctns Rabbit Polyclonal Antibody (orb579282) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_112541

Preservative

Lyophilized powder

AA Sequence

GQVTVFLHGNHSNQTCPRIRFLVIHSRIVSIINQVIGWIYFMAWSVSFYP

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

EGFR (GFR1195), CF640R conjugate, 0.1mg/mL
BNC401195-500 1x 500 µL

EGFR (GFR1195), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Tissue FFPE Sections, Synovium
CS713640 5x 5 µm

Tissue FFPE Sections, Synovium

Sign In for Pricing
View Details
Purified Anti-Human CD56 Antibody[B-A19]
E-AB-F1305A-01 25 µg

Purified Anti-Human CD56 Antibody[B-A19]

Sign In for Pricing
View Details
Purified Anti-Human CD56 Antibody[B-A19]
E-AB-F1305A-02 100 µg

Purified Anti-Human CD56 Antibody[B-A19]

Sign In for Pricing
View Details
FITC Syrian Hamster IgG Isotype Control[SHG-1]
E-AB-F09763C-01 25 µg

FITC Syrian Hamster IgG Isotype Control[SHG-1]

Sign In for Pricing
View Details
FITC Syrian Hamster IgG Isotype Control[SHG-1]
E-AB-F09763C-02 100 µg

FITC Syrian Hamster IgG Isotype Control[SHG-1]

Sign In for Pricing
View Details