Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Ctns Peptide - middle region

Ctns Peptide - middle region

Product Specifications

Product Name Alternative

AI195360, AW049661

UniProt

P57757

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Ctns Rabbit Polyclonal Antibody (orb579282) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_112541

Preservative

Lyophilized powder

AA Sequence

GQVTVFLHGNHSNQTCPRIRFLVIHSRIVSIINQVIGWIYFMAWSVSFYP

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Catapol
TRC-C215150-25MG 25 mg

Catapol

Sign In for Pricing
View Details
CFTR (Cystic Fibrosis Transmembrane Conductance Regulator) (CFTR/2290R), 0.2mg/mL
BNUB2290-100 1x 100 µL

CFTR (Cystic Fibrosis Transmembrane Conductance Regulator) (CFTR/2290R), 0.2mg/mL

Sign In for Pricing
View Details
CD79b (B-Cell Marker) (IGB/2940R), CF647 conjugate, 0.1mg/mL
BNC472940-100 1x 100 µL

CD79b (B-Cell Marker) (IGB/2940R), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Human CAMK1D activation kit by CRISPRa
GA111384 1 Kit

Human CAMK1D activation kit by CRISPRa

Sign In for Pricing
View Details
TRPM4 (NM_017636) Human Recombinant Protein
TP316888 20 µg

TRPM4 (NM_017636) Human Recombinant Protein

Sign In for Pricing
View Details
SMYD1 (NM_198274) Human Recombinant Protein
TP321269L 1 mg

SMYD1 (NM_198274) Human Recombinant Protein

Sign In for Pricing
View Details