Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Rora Peptide - N-terminal region

Rora Peptide - N-terminal region

Product Specifications

Product Name Alternative

9530021D13Rik, Nr1f1, ROR1, ROR2, ROR3, nmf267, sg, staggerer, tmgc26

UniProt

P51448

Field of Research

Stem Cell & Developmental Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Rora Rabbit Polyclonal Antibody (orb330433) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_038674

Preservative

Lyophilized powder

AA Sequence

MESAPAAPDPAASEPGSSGSEAAAGSRETPLTQDTGRKSEAPGAGRRQSY

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

FRMPD2 (NM_001018071) Human Over-expression Lysate
LY422722 100 µg

FRMPD2 (NM_001018071) Human Over-expression Lysate

Sign In for Pricing
View Details
ATG3 Antibody
KC-27127-01 50 μL

ATG3 Antibody

Sign In for Pricing
View Details
ATG3 Antibody
KC-27127-02 100 µL

ATG3 Antibody

Sign In for Pricing
View Details
ATG3 Antibody
KC-27127-03 1 mL

ATG3 Antibody

Sign In for Pricing
View Details
Mouse P-Selectin/CD62P, Tag Free (ECD)
HA211140-01 20 µg

Mouse P-Selectin/CD62P, Tag Free (ECD)

Sign In for Pricing
View Details
Mouse P-Selectin/CD62P, Tag Free (ECD)
HA211140-02 50 µg

Mouse P-Selectin/CD62P, Tag Free (ECD)

Sign In for Pricing
View Details