Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Rora Peptide - N-terminal region

Rora Peptide - N-terminal region

Product Specifications

Product Name Alternative

9530021D13Rik, Nr1f1, ROR1, ROR2, ROR3, nmf267, sg, staggerer, tmgc26

UniProt

P51448

Field of Research

Stem Cell & Developmental Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Rora Rabbit Polyclonal Antibody (orb330433) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_038674

Preservative

Lyophilized powder

AA Sequence

MESAPAAPDPAASEPGSSGSEAAAGSRETPLTQDTGRKSEAPGAGRRQSY

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CIB3 (NM_001300922) Human Tagged ORF Clone
RG235965 10 µg

CIB3 (NM_001300922) Human Tagged ORF Clone

Sign In for Pricing
View Details
TFF1 Rabbit Polyclonal Antibody
TA382457 100 µL

TFF1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Porcine Caveolin 1 (CAV1) ELISA Kit
RDR-CAV1-p-01 96 Tests

Porcine Caveolin 1 (CAV1) ELISA Kit

Sign In for Pricing
View Details
Porcine Caveolin 1 (CAV1) ELISA Kit
RDR-CAV1-p-02 48 Tests

Porcine Caveolin 1 (CAV1) ELISA Kit

Sign In for Pricing
View Details
Lansoprazole Sulfone N-Oxide
TRC-L175030-50MG 50 mg

Lansoprazole Sulfone N-Oxide

Sign In for Pricing
View Details
CLCA4 Rabbit Polyclonal Antibody
TA374836 100 µL

CLCA4 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details