Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Corin Peptide - C-terminal region

Corin Peptide - C-terminal region

Product Specifications

Product Name Alternative

AV273130, Lrp4

UniProt

Q9Z319

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Corin Rabbit Polyclonal Antibody (orb579865) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_058565

Preservative

Lyophilized powder

AA Sequence

MGNKMPFKLQEGEVRIIPLEQCQSYFDMKTITNRMICAGYESGTVDSCMG

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

EY-20 Reagent Tubes
13-020-50 1 Each

EY-20 Reagent Tubes

Sign In for Pricing
View Details
5HT4 Receptor (HTR4) (N-term) Rabbit Polyclonal Antibody
AP52130PU-N 400 µL

5HT4 Receptor (HTR4) (N-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Syntaxin 1a (STX1A) Mouse Monoclonal Antibody [Clone ID: OTI2D11]
CF812826 100 µg

Syntaxin 1a (STX1A) Mouse Monoclonal Antibody [Clone ID: OTI2D11]

Sign In for Pricing
View Details
Recombinant Human G-CSF Protein (Trx Tag)
PDEH100515-01 20 µg

Recombinant Human G-CSF Protein (Trx Tag)

Sign In for Pricing
View Details
Recombinant Human G-CSF Protein (Trx Tag)
PDEH100515-02 100 µg

Recombinant Human G-CSF Protein (Trx Tag)

Sign In for Pricing
View Details
Recombinant Human G-CSF Protein (Trx Tag)
PDEH100515-03 500 µg

Recombinant Human G-CSF Protein (Trx Tag)

Sign In for Pricing
View Details