Col15a1 Peptide - middle region
Col15a1 Peptide - middle region
Product Specifications
Field of Research
Cardiovascular Research
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with Col15a1 Rabbit Polyclonal Antibody (orb325380) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
XP_216399
Preservative
Lyophilized powder
AA Sequence
ASGQPGMKGEKGARGPNGSVGEKGDPGSRGLPGPPGKNGEVGIPGAMGPP
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
VAng-Lsx07032-500gEcoli 500 µg (E. coli)
Recombinant Shigella Dysenteriae nuoI Protein (aa 1-180)
Sign In for Pricing
View Details 
ARP66373_P050-FITC 100 µL
HABP4 Antibody - N-terminal region : FITC (ARP66373_P050-FITC)
Sign In for Pricing
View Details 
MBS6182605-01 0.1 mL
NPM1 (Nucleophosmin (Nucleolar Phosphoprotein B23, Numatrin), B23, MGC104254, NPM) (HRP)
Sign In for Pricing
View Details MBS6182605-02 5x 0.1 mL
NPM1 (Nucleophosmin (Nucleolar Phosphoprotein B23, Numatrin), B23, MGC104254, NPM) (HRP)
Sign In for Pricing
View Details