Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Col15a1 Peptide - middle region

Col15a1 Peptide - middle region

Product Specifications

Field of Research

Cardiovascular Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Col15a1 Rabbit Polyclonal Antibody (orb325380) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

XP_216399

Preservative

Lyophilized powder

AA Sequence

ASGQPGMKGEKGARGPNGSVGEKGDPGSRGLPGPPGKNGEVGIPGAMGPP

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Monoclonal Adenosine A2b R Antibody (2683F) [HRP]
FAB104442H 0.1 mL

Rabbit Monoclonal Adenosine A2b R Antibody (2683F) [HRP]

Sign In for Pricing
View Details
Rabbit anti-STBDl Antibody, Affinity Purified
A304-481A 100 µg

Rabbit anti-STBDl Antibody, Affinity Purified

Sign In for Pricing
View Details
Rabbit Polyclonal EIF3C Antibody [DyLight 650]
NB100-511C 100 µL

Rabbit Polyclonal EIF3C Antibody [DyLight 650]

Sign In for Pricing
View Details
Goat Anti-Mouse IgG H&L Antibody (DL800)
abx007446-01 100 µL

Goat Anti-Mouse IgG H&L Antibody (DL800)

Sign In for Pricing
View Details
Goat Anti-Mouse IgG H&L Antibody (DL800)
abx007446-02 500 µL

Goat Anti-Mouse IgG H&L Antibody (DL800)

Sign In for Pricing
View Details
ELISA Kit For Pleiotrophin
E1309r 96 Tests

ELISA Kit For Pleiotrophin

Sign In for Pricing
View Details