Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Tekt1 Peptide - N-terminal region

Tekt1 Peptide - N-terminal region

Product Specifications

Product Name Alternative

MT14

UniProt

Q9DAJ2

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Tekt1 Rabbit Polyclonal Antibody (orb580283) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_035699

Preservative

Lyophilized powder

AA Sequence

EEWYIANKSQYHRAEAQRSQSERLVAESQRLVEEIEKTTRKSQSDVNKKL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Monoclonal Spinesin Antibody (OTI4A11) [mFluor Violet 500 SE]
NBP2-74333MFV500 0.1 mL

Mouse Monoclonal Spinesin Antibody (OTI4A11) [mFluor Violet 500 SE]

Sign In for Pricing
View Details
Fatty Acid-Binding Protein, Intestinal (FABP2) Antibody
abx104155-01 100 µL

Fatty Acid-Binding Protein, Intestinal (FABP2) Antibody

Sign In for Pricing
View Details
Fatty Acid-Binding Protein, Intestinal (FABP2) Antibody
abx104155-02 200 µL

Fatty Acid-Binding Protein, Intestinal (FABP2) Antibody

Sign In for Pricing
View Details
Fatty Acid-Binding Protein, Intestinal (FABP2) Antibody
abx104155-03 1 mL

Fatty Acid-Binding Protein, Intestinal (FABP2) Antibody

Sign In for Pricing
View Details
PLV3-CMV-REG1A-3xFLAG-Puro Plasmid
PVT82486 2 µg

PLV3-CMV-REG1A-3xFLAG-Puro Plasmid

Sign In for Pricing
View Details
L-Selectin (lam1-116) Alexa Fluor® 594
sc-13505 AF594 200 µg/mL

L-Selectin (lam1-116) Alexa Fluor® 594

Sign In for Pricing
View Details