Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Galnt13 Peptide - C-terminal region

Galnt13 Peptide - C-terminal region

Product Specifications

Product Name Alternative

T13

UniProt

Q6UE39

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Galnt13 Rabbit Polyclonal Antibody (orb325563) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_954537

Preservative

Lyophilized powder

AA Sequence

EFKDFFYIISPGVVKVDYGDVSVRKTLRENLKCKPFSWYLENIYPDSQIP

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tropomyosin 3 (TPM3) (NM_001043353) Human Recombinant Protein
TP320212 20 µg

Tropomyosin 3 (TPM3) (NM_001043353) Human Recombinant Protein

Sign In for Pricing
View Details
Vertical Autoclave BAVT-504-B
BAVT-504-B 1 Unit

Vertical Autoclave BAVT-504-B

Sign In for Pricing
View Details
IL3RA / CD123 (Acute Myeloid Leukemia Marker) (IL3RA/2947R), CF740 conjugate, 0.1mg/mL
BNC742947-100 1x 100 µL

IL3RA / CD123 (Acute Myeloid Leukemia Marker) (IL3RA/2947R), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
C14orf93 Human Gene Knockout Kit (CRISPR)
KN421403 1 Kit

C14orf93 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Myb Rabbit Polyclonal Antibody
AP09406PU-S 25 µL

Myb Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
GFAP (ASTRO/789), Biotin conjugate, 0.1mg/mL
BNCB0789-500 1x 500 µL

GFAP (ASTRO/789), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details