Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Galnt13 Peptide - C-terminal region

Galnt13 Peptide - C-terminal region

Product Specifications

Product Name Alternative

T13

UniProt

Q6UE39

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Galnt13 Rabbit Polyclonal Antibody (orb325563) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_954537

Preservative

Lyophilized powder

AA Sequence

EFKDFFYIISPGVVKVDYGDVSVRKTLRENLKCKPFSWYLENIYPDSQIP

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Angiotensin II Trifluoroacetic Acid Salt (Human)
TRC-A637965-50MG 50 mg

Angiotensin II Trifluoroacetic Acid Salt (Human)

Sign In for Pricing
View Details
C1orf86 (FAAP20) (NM_001282670) Human Tagged ORF Clone
RG237172 10 µg

C1orf86 (FAAP20) (NM_001282670) Human Tagged ORF Clone

Sign In for Pricing
View Details
Phosphoric Acid Diammonium Salt
TRC-P359205-50G 50 g

Phosphoric Acid Diammonium Salt

Sign In for Pricing
View Details
RBPJK (RBPJ) Human Gene Knockout Kit (CRISPR)
KN204791LP 1 Kit

RBPJK (RBPJ) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
METT11D1 (METTL17) Human Gene Knockout Kit (CRISPR)
KN415057 1 Kit

METT11D1 (METTL17) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Aldh3b2 Mouse Gene Knockout Kit (CRISPR)
KN501122 1 Kit

Aldh3b2 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details