Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Cdo1 Peptide - C-terminal region

Cdo1 Peptide - C-terminal region

Product Specifications

UniProt

P21816

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Cdo1 Rabbit Polyclonal Antibody (orb581520) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_434696

Preservative

Lyophilized powder

AA Sequence

RTLRENQCAYINDSIGLHRVENVSHTEPAVSLHLYSPPFDTCHAFDQRTG

More Discoveries

Explore Other Products

Browse additional items from our catalog

TRNAG6 Lentiviral Vector (Human) (UbC) (pLenti-GIII-UbC)
LV751953 1.0 µg DNA

TRNAG6 Lentiviral Vector (Human) (UbC) (pLenti-GIII-UbC)

Sign In for Pricing
View Details
RIMS3 siRNA Oligos set (Human)
39597171 3x 5 nmol

RIMS3 siRNA Oligos set (Human)

Sign In for Pricing
View Details
Recombinant Mouse MRPL15 Protein, His (Fc)-Avi-tagged
MRPL15-5688M 50 µg

Recombinant Mouse MRPL15 Protein, His (Fc)-Avi-tagged

Sign In for Pricing
View Details
Phospho-C5R1 (Ser334) Antibody
MBS9614362-01 0.05 mL

Phospho-C5R1 (Ser334) Antibody

Sign In for Pricing
View Details
Phospho-C5R1 (Ser334) Antibody
MBS9614362-02 0.1 mL

Phospho-C5R1 (Ser334) Antibody

Sign In for Pricing
View Details
Phospho-C5R1 (Ser334) Antibody
MBS9614362-03 0.2 mL

Phospho-C5R1 (Ser334) Antibody

Sign In for Pricing
View Details