Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Cdo1 Peptide - C-terminal region

Cdo1 Peptide - C-terminal region

Product Specifications

UniProt

P21816

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Cdo1 Rabbit Polyclonal Antibody (orb581520) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_434696

Preservative

Lyophilized powder

AA Sequence

RTLRENQCAYINDSIGLHRVENVSHTEPAVSLHLYSPPFDTCHAFDQRTG

More Discoveries

Explore Other Products

Browse additional items from our catalog

MYC2 Rabbit pAb
MBS9146040-01 0.02 mL

MYC2 Rabbit pAb

Sign In for Pricing
View Details
MYC2 Rabbit pAb
MBS9146040-02 0.1 mL

MYC2 Rabbit pAb

Sign In for Pricing
View Details
MYC2 Rabbit pAb
MBS9146040-03 5x 0.1 mL

MYC2 Rabbit pAb

Sign In for Pricing
View Details
AI987944 ORF Vector (Mouse) (pORF)
11592015 1.0 µg DNA

AI987944 ORF Vector (Mouse) (pORF)

Sign In for Pricing
View Details
2- (3-chloro-4-methoxy-5-methylphenyl) propan-2-ol
OR1086514-01 250 mg

2- (3-chloro-4-methoxy-5-methylphenyl) propan-2-ol

Sign In for Pricing
View Details
2- (3-chloro-4-methoxy-5-methylphenyl) propan-2-ol
OR1086514-02 500 mg

2- (3-chloro-4-methoxy-5-methylphenyl) propan-2-ol

Sign In for Pricing
View Details