Ldlrap1 Peptide - C-terminal region
Ldlrap1 Peptide - C-terminal region
Product Specifications
Product Name Alternative
AA691260, ARH2, Arh, Arh1, FHCB1, FHCB2
Field of Research
Metabolism Research
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with Ldlrap1 Rabbit Polyclonal Antibody (orb582709) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_663529
Preservative
Lyophilized powder
AA Sequence
APLSTVSANTNNVDETPRPQVLGNNSVVWELDDGLDEAFSRLAQSRTNPQ
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNCB3170-500 1x 500 µL
CD79b (B-Cell Marker) (IGB/3170R), Biotin conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
LY419139 100 µg
Hex (HHEX) (NM_002729) Human Over-expression Lysate
Sign In for Pricing
View Details