Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Hddc3 Peptide - middle region

Hddc3 Peptide - middle region

Product Specifications

Product Name Alternative

RGD1311839

UniProt

D4A500

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Hddc3 Rabbit Polyclonal Antibody (orb582936) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001100998

Preservative

Lyophilized powder

AA Sequence

EVELHFGAQVRRLVEEVTDDKTLPKLERKRQQVEQAPHSSPGAKLVKLAD

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RNase A for biochemistry
1341GR150 150 g

RNase A for biochemistry

Sign In for Pricing
View Details
Anti-TAS2R10 Antibody Picoband®, FITC Conjugate
A10959-2-FITC 100 µg/Vial

Anti-TAS2R10 Antibody Picoband®, FITC Conjugate

Sign In for Pricing
View Details
Human THRa ELISA Kit
orb442539-01 48 Tests

Human THRa ELISA Kit

Sign In for Pricing
View Details
Human THRa ELISA Kit
orb442539-02 96 Tests

Human THRa ELISA Kit

Sign In for Pricing
View Details
Olfr133 CRISPR Activation Plasmid (m2)
sc-434937-ACT-2 20 µg

Olfr133 CRISPR Activation Plasmid (m2)

Sign In for Pricing
View Details
APC Linked Monoclonal Antibody to NTerminal ProAtrial Natriuretic Peptide (NTProANP)
MBS2129605-01 0.1 mL

APC Linked Monoclonal Antibody to NTerminal ProAtrial Natriuretic Peptide (NTProANP)

Sign In for Pricing
View Details