Hddc3 Peptide - middle region
Hddc3 Peptide - middle region
Product Specifications
Product Name Alternative
RGD1311839
UniProt
D4A500
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with Hddc3 Rabbit Polyclonal Antibody (orb582936) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_001100998
Preservative
Lyophilized powder
AA Sequence
EVELHFGAQVRRLVEEVTDDKTLPKLERKRQQVEQAPHSSPGAKLVKLAD
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
128953-ML490 100 µL
KRT35 (HHA5, HKA5, KRTHA5, Keratin, Type I Cuticular Ha5, Hair Keratin, Type I Ha5, Keratin-35) (MaxLight 490)
Sign In for Pricing
View Details 
PL013-5X100ML 5x 100 mL
Nitsch & Nitsch Macroelements Solution (10X)
Sign In for Pricing
View Details ![1- (Aminomethyl) -3-methyl-2-oxabicyclo[2.1.1]hexane-4-carboxylic acid hydrochloride](https://cdn.genprice.uk/genprice/uk/genprice2.webp)
DPD29836-01 50 mg
1- (Aminomethyl) -3-methyl-2-oxabicyclo[2.1.1]hexane-4-carboxylic acid hydrochloride
Sign In for Pricing
View Details DPD29836-02 0.5 g
1- (Aminomethyl) -3-methyl-2-oxabicyclo[2.1.1]hexane-4-carboxylic acid hydrochloride
Sign In for Pricing
View Details 
NBP2-97981AF647 0.1 mL
Rabbit Polyclonal ZP2 Antibody [Alexa Fluor 647]
Sign In for Pricing
View Details