Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Rps8 Peptide - C-terminal region

Rps8 Peptide - C-terminal region

Product Specifications

UniProt

P62242

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Rps8 Rabbit Polyclonal Antibody (orb583030) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_033124

Preservative

Lyophilized powder

AA Sequence

KKYDERKKNAKISSLLEEQFQQGKLLACIASRPGQCGRADGYVLEGKELE

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PE Rat IgG2b, κ Isotype Control[LTF-2]
E-AB-F09842D-01 20 Tests

PE Rat IgG2b, κ Isotype Control[LTF-2]

Sign In for Pricing
View Details
PE Rat IgG2b, κ Isotype Control[LTF-2]
E-AB-F09842D-02 100 Tests

PE Rat IgG2b, κ Isotype Control[LTF-2]

Sign In for Pricing
View Details
PE Rat IgG2b, κ Isotype Control[LTF-2]
E-AB-F09842D-03 2x 100 Tests

PE Rat IgG2b, κ Isotype Control[LTF-2]

Sign In for Pricing
View Details
20-Hydroxyecdysone ELISA Ki
K066-H1 1 Plate

20-Hydroxyecdysone ELISA Ki

Sign In for Pricing
View Details
LRRC10B Human Gene Knockout Kit (CRISPR)
KN427461 1 Kit

LRRC10B Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
CLCN4 Human Gene Knockout Kit (CRISPR)
KN417040 1 Kit

CLCN4 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details