Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Rps8 Peptide - C-terminal region

Rps8 Peptide - C-terminal region

Product Specifications

UniProt

P62242

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Rps8 Rabbit Polyclonal Antibody (orb583030) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_033124

Preservative

Lyophilized powder

AA Sequence

KKYDERKKNAKISSLLEEQFQQGKLLACIASRPGQCGRADGYVLEGKELE

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

HER-4 / ERBB4 (HFR-1), Biotin conjugate, 0.1mg/mL
BNCB2379-500 1x 500 µL

HER-4 / ERBB4 (HFR-1), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Tissue FFPE Sections, Prostate
CS806064 5x 5 µm

Tissue FFPE Sections, Prostate

Sign In for Pricing
View Details
PPP2R2A (NM_001177591) Human Over-expression Lysate
LC433117 20 µg

PPP2R2A (NM_001177591) Human Over-expression Lysate

Sign In for Pricing
View Details
Glucosidase 2 subunit beta Recombinant Mouse Monoclonal Antibody [A6H9-R]
HA601276 100 µL

Glucosidase 2 subunit beta Recombinant Mouse Monoclonal Antibody [A6H9-R]

Sign In for Pricing
View Details
CHD1 Human Gene Knockout Kit (CRISPR)
KN421575 1 Kit

CHD1 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Recombinant Human Tie-2 (C-Fc)
PKSH033870-01 10 µg

Recombinant Human Tie-2 (C-Fc)

Sign In for Pricing
View Details