Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Rps6ka2 Peptide - C-terminal region

Rps6ka2 Peptide - C-terminal region

Product Specifications

Product Name Alternative

90kDa, D17Wsu134e, Rps6ka-rs1, Rsk3, p90rsk, pp90rsk

UniProt

Q9WUT3

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Rps6ka2 Rabbit Polyclonal Antibody (orb583036) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_035429

Preservative

Lyophilized powder

AA Sequence

KMLHVDPQQRLTAVQVLKHPWIVNREYLSQNQLSRQDVHLVKGAMAATYF

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Caspase recruitment domain-containing protein 9 (CARD9) Rat ELISA Kit
C1721 96 Tests

Caspase recruitment domain-containing protein 9 (CARD9) Rat ELISA Kit

Sign In for Pricing
View Details
2-Chloroethyl Methanethiosulfonate
C4980-50 10 mg

2-Chloroethyl Methanethiosulfonate

Sign In for Pricing
View Details
MARCHF8 (NM_145021) Human Over-expression Lysate
E45H14161-2 20 µg

MARCHF8 (NM_145021) Human Over-expression Lysate

Sign In for Pricing
View Details
TSHZ2 Protein Vector (Mouse) (pPM-C-His)
PV242301 500 ng

TSHZ2 Protein Vector (Mouse) (pPM-C-His)

Sign In for Pricing
View Details
LIM Domain Kinase 2 Phospho-Thr505 (LIMK2 pT505) Antibody
abx333204 100 µL

LIM Domain Kinase 2 Phospho-Thr505 (LIMK2 pT505) Antibody

Sign In for Pricing
View Details
Lithium oxide
OR1026997-01 5 g

Lithium oxide

Sign In for Pricing
View Details