Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Rps6ka2 Peptide - C-terminal region

Rps6ka2 Peptide - C-terminal region

Product Specifications

Product Name Alternative

90kDa, D17Wsu134e, Rps6ka-rs1, Rsk3, p90rsk, pp90rsk

UniProt

Q9WUT3

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Rps6ka2 Rabbit Polyclonal Antibody (orb583036) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_035429

Preservative

Lyophilized powder

AA Sequence

KMLHVDPQQRLTAVQVLKHPWIVNREYLSQNQLSRQDVHLVKGAMAATYF

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Multiplex Assay Kit for Leucyl/Cystinyl Aminopeptidase (LNPEP), etc. by FLIA (Flow Luminescence Immunoassay)
TRV-0031296 96 Tests

Multiplex Assay Kit for Leucyl/Cystinyl Aminopeptidase (LNPEP), etc. by FLIA (Flow Luminescence Immunoassay)

Sign In for Pricing
View Details
MicroCrystal Mount Assortmentbox of 20; Model #6on 18mm rods
M4-L18SP-6 20 Mounts

MicroCrystal Mount Assortmentbox of 20; Model #6on 18mm rods

Sign In for Pricing
View Details
S-Fesoterodine-d7 Fumarate
166434 1 mg

S-Fesoterodine-d7 Fumarate

Sign In for Pricing
View Details
ADAM9 Protein (C-6xHis Tag, )
P510036 100 µg

ADAM9 Protein (C-6xHis Tag, )

Sign In for Pricing
View Details
Vom2r62 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Rat)
K6072305 3x 1.0 µg

Vom2r62 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Rat)

Sign In for Pricing
View Details
C4ORF34 Adenovirus (Human)
14537051 1.0 mL

C4ORF34 Adenovirus (Human)

Sign In for Pricing
View Details