Atp6v1b1 Peptide - N-terminal region
Atp6v1b1 Peptide - N-terminal region
Product Specifications
Product Name Alternative
AW208839, Atp6b1, D630003L15, D630030L16Rik, D630039P21Rik, Vpp-3, Vpp3
UniProt
Q91YH6
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with Atp6v1b1 Rabbit Polyclonal Antibody (orb583105) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_598918
Preservative
Lyophilized powder
AA Sequence
PRVTYRTVCSVNGPLVVLDQVKFAQYAEIVNFTLPDGTQRSGQVLEVAGT
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC400096-100 1x 100 µL
Histone H1 (AE-4), CF640R conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC470204-500 1x 500 µL
Complement C4d (C4D204), CF647 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC470181-100 1x 100 µL
CD59 (heavy chain of Protectin) (BRA-10G), CF647 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC042497-500 1x 500 µL
Bcl-6 (Follicular Lymphoma Marker) (BCL6/2497R), CF405S conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC042905-500 1x 500 µL
CD29 (Stem Cell Marker) (12G10), CF405S conjugate, 0.1mg/mL
Sign In for Pricing
View Details