Etv3l Peptide - middle region
Etv3l Peptide - middle region
Product Specifications
Product Name Alternative
RGD1562620
UniProt
A0JPP2
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with Etv3l Rabbit Polyclonal Antibody (orb583807) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_001094462
Preservative
Lyophilized powder
AA Sequence
HVIAWQQGEYGEFVIKDPDEVARLWGRRKCKPQMNYDKLSRALRYYYNKR
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
AMM00174G 0.05mg
Monoclonal MUC18 / CD146 / MCAM (Melanoma Cell Adhesion Molecule) Antibody - With BSA and Azide, Clone: OJ79c
Sign In for Pricing
View Details 
K4161502 1.0 µg DNA
Lman1l sgRNA CRISPR Lentivector (Mouse) (Target 1)
Sign In for Pricing
View Details NBP2-32881-0.02mg 0.02 mg
Mouse Monoclonal Myeloid Cell Marker Antibody (SPM298)
Sign In for Pricing
View Details 032454-AP 200 µL
Bcl-2, BH3 Domain Specific (BCL2, Apoptosis regulator Bcl-2) (AP) discontinued
Sign In for Pricing
View Details