Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FASTKD3 Peptide - N-terminal region

FASTKD3 Peptide - N-terminal region

Product Specifications

UniProt

Q14CZ7

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with FASTKD3 Rabbit Polyclonal Antibody (orb586825) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_076996

Preservative

Lyophilized powder

AA Sequence

TMETLPDTMAAGALQRICEVEKKDGDQGLPKEILENSIFQALCFQFEKEP

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

DHEA (Dehydroepiandrosterone) ELISA Kit
E-EL-0115-01 24 Tests

DHEA (Dehydroepiandrosterone) ELISA Kit

Sign In for Pricing
View Details
DHEA (Dehydroepiandrosterone) ELISA Kit
E-EL-0115-02 48 Tests

DHEA (Dehydroepiandrosterone) ELISA Kit

Sign In for Pricing
View Details
DHEA (Dehydroepiandrosterone) ELISA Kit
E-EL-0115-03 96 Tests

DHEA (Dehydroepiandrosterone) ELISA Kit

Sign In for Pricing
View Details
Metabotropic Glutamate Receptor 2 (GRM2) Human Gene Knockout Kit (CRISPR)
KN418103 1 Kit

Metabotropic Glutamate Receptor 2 (GRM2) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
ATP6V1C1 (NM_001695) Human Over-expression Lysate
LC419795 20 µg

ATP6V1C1 (NM_001695) Human Over-expression Lysate

Sign In for Pricing
View Details
QKI-5 Recombinant Chimeric Antibody Antibody
HA601501 100 µL

QKI-5 Recombinant Chimeric Antibody Antibody

Sign In for Pricing
View Details