Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FASTKD3 Peptide - N-terminal region

FASTKD3 Peptide - N-terminal region

Product Specifications

UniProt

Q14CZ7

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with FASTKD3 Rabbit Polyclonal Antibody (orb586825) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_076996

Preservative

Lyophilized powder

AA Sequence

TMETLPDTMAAGALQRICEVEKKDGDQGLPKEILENSIFQALCFQFEKEP

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tissue Total RNA, Lung
CR561290 5 µg

Tissue Total RNA, Lung

Sign In for Pricing
View Details
HRK Polyclonal Antibody
E-AB-16495-01 20 µL

HRK Polyclonal Antibody

Sign In for Pricing
View Details
HRK Polyclonal Antibody
E-AB-16495-02 60 µL

HRK Polyclonal Antibody

Sign In for Pricing
View Details
HRK Polyclonal Antibody
E-AB-16495-03 120 µL

HRK Polyclonal Antibody

Sign In for Pricing
View Details
HRK Polyclonal Antibody
E-AB-16495-04 200 µL

HRK Polyclonal Antibody

Sign In for Pricing
View Details
MCAM (Melanoma Cell Adhesion Molecule) / MUC18 / CD146 (MCAM/3046), CF594 conjugate, 0.1mg/mL
BNC943046-100 1x 100 µL

MCAM (Melanoma Cell Adhesion Molecule) / MUC18 / CD146 (MCAM/3046), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details