MS4A6E Peptide - middle region
MS4A6E Peptide - middle region
Product Specifications
UniProt
Q96DS6
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with MS4A6E Rabbit Polyclonal Antibody (orb586856) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_640342
Preservative
Lyophilized powder
AA Sequence
FILLSVNPAALNPASLQCKLDEKDIPTRLLLSYDYHSPYTMDCHRAKASL
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
039980-Biotin 200 µL
PI3KC3 (S425) (PIK3C3, VPS34, Phosphatidylinositol 3-kinase catalytic subunit type 3, Phosphatidylinositol 3-kinase p100 subunit, Phosphoinositide-3-kinase class 3, hVps34) (Biotin) discontinued
Sign In for Pricing
View Details 
BNC940678-500 1x 500 µL
Involucrin (SY5), CF594 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
MBS2083472-01 0.1 mL
HRP-Linked Polyclonal Antibody to Nuclear Factor, Erythroid Derived 2 Like Protein 2 (NFE2L2)
Sign In for Pricing
View Details MBS2083472-02 0.2 mL
HRP-Linked Polyclonal Antibody to Nuclear Factor, Erythroid Derived 2 Like Protein 2 (NFE2L2)
Sign In for Pricing
View Details MBS2083472-03 0.5 mL
HRP-Linked Polyclonal Antibody to Nuclear Factor, Erythroid Derived 2 Like Protein 2 (NFE2L2)
Sign In for Pricing
View Details MBS2083472-04 1 mL
HRP-Linked Polyclonal Antibody to Nuclear Factor, Erythroid Derived 2 Like Protein 2 (NFE2L2)
Sign In for Pricing
View Details