Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MTMR7 Peptide - C-terminal region

MTMR7 Peptide - C-terminal region

Product Specifications

UniProt

Q9Y216

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with MTMR7 Rabbit Polyclonal Antibody (orb586858) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_004677

Preservative

Lyophilized powder

AA Sequence

NLKSSDPDLSANSDQESGVEDLSCRSPSGGEHAPSEDSGKDRDSDEAVFL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human CDC2 Kinase/CDK1 Protein (GST Tag)
PKSH031451 50 µg

Recombinant Human CDC2 Kinase/CDK1 Protein (GST Tag)

Sign In for Pricing
View Details
Frozen Tissue Sections, Prostate
CS634528 5x 5 µm

Frozen Tissue Sections, Prostate

Sign In for Pricing
View Details
KAP1 Antibody
KC-8469-01 50 μL

KAP1 Antibody

Sign In for Pricing
View Details
KAP1 Antibody
KC-8469-02 100 µL

KAP1 Antibody

Sign In for Pricing
View Details
KAP1 Antibody
KC-8469-03 1 mL

KAP1 Antibody

Sign In for Pricing
View Details
Thrombomodulin / CD141 (Endothelial Cell Marker) (THBD/1782), CF405S conjugate, 0.1mg/mL
BNC041782-100 1x 100 µL

Thrombomodulin / CD141 (Endothelial Cell Marker) (THBD/1782), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details