Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MTMR7 Peptide - C-terminal region

MTMR7 Peptide - C-terminal region

Product Specifications

UniProt

Q9Y216

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with MTMR7 Rabbit Polyclonal Antibody (orb586858) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_004677

Preservative

Lyophilized powder

AA Sequence

NLKSSDPDLSANSDQESGVEDLSCRSPSGGEHAPSEDSGKDRDSDEAVFL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MPRG Antibody
8G389-AAT 50 µg

MPRG Antibody

Sign In for Pricing
View Details
Sutezolid
TRC-S880003-5MG 5 mg

Sutezolid

Sign In for Pricing
View Details
Vortioxetine Hydrobromide
TRC-V766000-50MG 50 mg

Vortioxetine Hydrobromide

Sign In for Pricing
View Details
RECK Antibody
8C10249-AAT 50 µg

RECK Antibody

Sign In for Pricing
View Details
Uncoated Human TTR (Transthyretin) ELISA Kit
E-UNEL-H0223-01 5x 96 Tests

Uncoated Human TTR (Transthyretin) ELISA Kit

Sign In for Pricing
View Details
Uncoated Human TTR (Transthyretin) ELISA Kit
E-UNEL-H0223-02 15x 96 Tests

Uncoated Human TTR (Transthyretin) ELISA Kit

Sign In for Pricing
View Details