Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PDZD7 Peptide - C-terminal region

PDZD7 Peptide - C-terminal region

Product Specifications

Product Name Alternative

PDZK7

UniProt

Q9H5P4

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with PDZD7 Rabbit Polyclonal Antibody (orb586876) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_079171

Preservative

Lyophilized powder

AA Sequence

LSRPRPPITRSQSYLTLWEEKQQRKKEKSGSPGEKGALQRSKTLMNLFFK

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SOCS2 Polyclonal Antibody
E-AB-14356-01 20 µL

SOCS2 Polyclonal Antibody

Sign In for Pricing
View Details
SOCS2 Polyclonal Antibody
E-AB-14356-02 60 µL

SOCS2 Polyclonal Antibody

Sign In for Pricing
View Details
SOCS2 Polyclonal Antibody
E-AB-14356-03 120 µL

SOCS2 Polyclonal Antibody

Sign In for Pricing
View Details
SOCS2 Polyclonal Antibody
E-AB-14356-04 200 µL

SOCS2 Polyclonal Antibody

Sign In for Pricing
View Details
GABRA3 CRISPR Knock Out 293T Cell Line (Human)
21154141 1x 10^6 Cells / 1.0 mL

GABRA3 CRISPR Knock Out 293T Cell Line (Human)

Sign In for Pricing
View Details
Phospho-GSK-3 Beta (Ser9) Polyclonal Antibody, APC Conjugated
bs-2066R-APC 100 µL

Phospho-GSK-3 Beta (Ser9) Polyclonal Antibody, APC Conjugated

Sign In for Pricing
View Details