Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PDZD7 Peptide - C-terminal region

PDZD7 Peptide - C-terminal region

Product Specifications

Product Name Alternative

PDZK7

UniProt

Q9H5P4

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with PDZD7 Rabbit Polyclonal Antibody (orb586876) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_079171

Preservative

Lyophilized powder

AA Sequence

LSRPRPPITRSQSYLTLWEEKQQRKKEKSGSPGEKGALQRSKTLMNLFFK

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Lipocalin-15 (LCN15) Elisa Kit
EK712869 96 Well

Human Lipocalin-15 (LCN15) Elisa Kit

Sign In for Pricing
View Details
P3X63Ag8.653 cells
C0003028 One Frozen Vial

P3X63Ag8.653 cells

Sign In for Pricing
View Details
GNL3L Polyclonal Antibody, AbBy Fluor™ 680 Conjugated
bs-13472R-BF680 100 µL

GNL3L Polyclonal Antibody, AbBy Fluor™ 680 Conjugated

Sign In for Pricing
View Details
Recombinant Human PFN2 Protein
orb2994600-01 10 µg

Recombinant Human PFN2 Protein

Sign In for Pricing
View Details
Recombinant Human PFN2 Protein
orb2994600-02 50 µg

Recombinant Human PFN2 Protein

Sign In for Pricing
View Details
Recombinant Human PFN2 Protein
orb2994600-03 500 µg

Recombinant Human PFN2 Protein

Sign In for Pricing
View Details