Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PEX11G Peptide - C-terminal region

PEX11G Peptide - C-terminal region

Product Specifications

UniProt

Q96HA9

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with PEX11G Rabbit Polyclonal Antibody (orb586878) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_542393

Preservative

Lyophilized powder

AA Sequence

LANAVHWLPRGVLWAGRFPPWLVGLMGTISSILSMYQAARAGGQAEATTP

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PREI3 (MOB4) (NM_015387) Human Over-expression Lysate
LY402432 100 µg

PREI3 (MOB4) (NM_015387) Human Over-expression Lysate

Sign In for Pricing
View Details
Unconjugated Rabbit Anti-PHA-E Antibody
AL-1802-2 2 mL

Unconjugated Rabbit Anti-PHA-E Antibody

Sign In for Pricing
View Details
Frozen Tissue Blocks, Breast
CB521678 1 Block

Frozen Tissue Blocks, Breast

Sign In for Pricing
View Details
AF067061 Mouse Gene Knockout Kit (CRISPR)
KN500947 1 Kit

AF067061 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Human WSCD1 activation kit by CRISPRa
GA108201 1 Kit

Human WSCD1 activation kit by CRISPRa

Sign In for Pricing
View Details
VEGI (Vascular Endothelial Growth Inhibitor) (VEGI/1283), Biotin conjugate, 0.1mg/mL
BNCB1283-500 1x 500 µL

VEGI (Vascular Endothelial Growth Inhibitor) (VEGI/1283), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details