Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PEX11G Peptide - C-terminal region

PEX11G Peptide - C-terminal region

Product Specifications

UniProt

Q96HA9

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with PEX11G Rabbit Polyclonal Antibody (orb586878) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_542393

Preservative

Lyophilized powder

AA Sequence

LANAVHWLPRGVLWAGRFPPWLVGLMGTISSILSMYQAARAGGQAEATTP

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PE/Cyanine7 Anti-Mouse CD90 Antibody[M5/49.4.1]
E-AB-F1283UH-01 25 µg

PE/Cyanine7 Anti-Mouse CD90 Antibody[M5/49.4.1]

Sign In for Pricing
View Details
PE/Cyanine7 Anti-Mouse CD90 Antibody[M5/49.4.1]
E-AB-F1283UH-02 100 µg

PE/Cyanine7 Anti-Mouse CD90 Antibody[M5/49.4.1]

Sign In for Pricing
View Details
Chromogranin A (LK2H10), CF594 conjugate, 0.1mg/mL
BNC940641-100 1x 100 µL

Chromogranin A (LK2H10), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Human TMEM251 activation kit by CRISPRa
GA108790 1 Kit

Human TMEM251 activation kit by CRISPRa

Sign In for Pricing
View Details
Cytokeratin 19 (KRT19/800), CF647 conjugate, 0.1mg/mL
BNC470800-100 1x 100 µL

Cytokeratin 19 (KRT19/800), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
UBE2E3 Human Gene Knockout Kit (CRISPR)
KN400274 1 Kit

UBE2E3 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details