Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PRSS33 Peptide - C-terminal region

PRSS33 Peptide - C-terminal region

Product Specifications

Product Name Alternative

EOS

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with PRSS33 Rabbit Polyclonal Antibody (orb586885) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_690851

Preservative

Lyophilized powder

AA Sequence

GYPQGHKDACQGDSGGPLTCLQSGSWVLVGVVSWGKGCALPNRPGVYTSV

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

HYPE Polyclonal Antibody, APC-Cy5.5 Conjugated
bs-11698R-APC-Cy5.5 100 µL

HYPE Polyclonal Antibody, APC-Cy5.5 Conjugated

Sign In for Pricing
View Details
N, N-Dimethyl-d6-glycine Hydrochloride
165522 10 mg

N, N-Dimethyl-d6-glycine Hydrochloride

Sign In for Pricing
View Details
TCL1A (T-Cell Leukemia/Lymphoma 1A, TCL1) (AP) discontinued
252496-AP 100 µL

TCL1A (T-Cell Leukemia/Lymphoma 1A, TCL1) (AP) discontinued

Sign In for Pricing
View Details
Human KIAA1576 (VAT1L) (NM_020927) AAV Particle
RC207266A1V 250 µL

Human KIAA1576 (VAT1L) (NM_020927) AAV Particle

Sign In for Pricing
View Details
WWOX Rabbit Polyclonal Antibody
TA351957 100 µL

WWOX Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Anti-Human CD32/FCGR2A Antibody (SAA1415), PE
FHC93532 100 Tests

Anti-Human CD32/FCGR2A Antibody (SAA1415), PE

Sign In for Pricing
View Details