Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PRSS33 Peptide - C-terminal region

PRSS33 Peptide - C-terminal region

Product Specifications

Product Name Alternative

EOS

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with PRSS33 Rabbit Polyclonal Antibody (orb586885) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_690851

Preservative

Lyophilized powder

AA Sequence

GYPQGHKDACQGDSGGPLTCLQSGSWVLVGVVSWGKGCALPNRPGVYTSV

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Ranbp17 Adenovirus (Mouse)
38475054 1.0 mL

Ranbp17 Adenovirus (Mouse)

Sign In for Pricing
View Details
EXT1, ID (EXT1, Exostosin-1, Glucuronosyl-N-acetylglucosaminyl-proteoglycan/N-acetylglucosaminyl-proteoglycan 4-alpha-N-acetylglucosaminyltransferase, Multiple exostoses protein 1, Putative tumor suppressor protein EXT1) (PE) discontinued
035276-PE 200 µL

EXT1, ID (EXT1, Exostosin-1, Glucuronosyl-N-acetylglucosaminyl-proteoglycan/N-acetylglucosaminyl-proteoglycan 4-alpha-N-acetylglucosaminyltransferase, Multiple exostoses protein 1, Putative tumor suppressor protein EXT1) (PE) discontinued

Sign In for Pricing
View Details
Rabbit Polyclonal GNAT2 Antibody
NBP3-04537-100ul 100 µL

Rabbit Polyclonal GNAT2 Antibody

Sign In for Pricing
View Details
Lentiviral human PRKAR1B shRNA (UAS) - Lentiviral human PRKAR1B shRNA (UAS, RFP) (25)
GTR15096767 1 Vial

Lentiviral human PRKAR1B shRNA (UAS) - Lentiviral human PRKAR1B shRNA (UAS, RFP) (25)

Sign In for Pricing
View Details
Recombinant Der f 21
E4A10V53 100 µg

Recombinant Der f 21

Sign In for Pricing
View Details
Surfactant Associated Protein D (Biotin)
550087 200 µL

Surfactant Associated Protein D (Biotin)

Sign In for Pricing
View Details