Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RSPH4A Peptide - N-terminal region

RSPH4A Peptide - N-terminal region

Product Specifications

Product Name Alternative

CILD11, RSHL3, RSPH6B, dJ412I7.1

UniProt

Q5TD94

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with RSPH4A Rabbit Polyclonal Antibody (orb326682) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001010892

Preservative

Lyophilized powder

AA Sequence

APPQSDRTTSVIPEAGTPYPDPLEQSSDKRESTPHHTSQSEGNTFQQSQQ

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral human ADAMTSL4 sgRNA gene knockout kit - Lentiviral human ADAMTSL4 sgRNA gene knockout kit (25)
GTR15386079 1 Vial

Lentiviral human ADAMTSL4 sgRNA gene knockout kit - Lentiviral human ADAMTSL4 sgRNA gene knockout kit (25)

Sign In for Pricing
View Details
Z-Tyr(tBu)-OH·DCHA
5-07566 25 g

Z-Tyr(tBu)-OH·DCHA

Sign In for Pricing
View Details
4-1BB; TNFRSF9 Protein (C-Fc-His, Human)
P512930 100 µg

4-1BB; TNFRSF9 Protein (C-Fc-His, Human)

Sign In for Pricing
View Details
SLC5111312 HCl
orb1699282-01 500 µg

SLC5111312 HCl

Sign In for Pricing
View Details
SLC5111312 HCl
orb1699282-02 1 mg

SLC5111312 HCl

Sign In for Pricing
View Details
SLC5111312 HCl
orb1699282-03 5 mg

SLC5111312 HCl

Sign In for Pricing
View Details