Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SGCZ Peptide - C-terminal region

SGCZ Peptide - C-terminal region

Product Specifications

Product Name Alternative

ZSG1

UniProt

Q96LD1

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with SGCZ Rabbit Polyclonal Antibody (orb326684) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_631906

Preservative

Lyophilized powder

AA Sequence

EPSQDLRLESPTRSLIMEAPRGVQVSAAAGDFKATCRKELHLQSTEGEIF

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Olr1570 Protein Vector (Rat) (pPM-C-HA)
PV288612 500 ng

Olr1570 Protein Vector (Rat) (pPM-C-HA)

Sign In for Pricing
View Details
CAST Protein Lysate (Rat) with C-HA Tag
15084036 100 µg

CAST Protein Lysate (Rat) with C-HA Tag

Sign In for Pricing
View Details
RGS9 Protein Vector (Rat) (pPM-C-HA)
PV301304 500 ng

RGS9 Protein Vector (Rat) (pPM-C-HA)

Sign In for Pricing
View Details
Gax Rabbit pAb, BF700 conjugated
orb2875453 100 µL

Gax Rabbit pAb, BF700 conjugated

Sign In for Pricing
View Details
Nori® Hamster FGFa ELISA Kit
GR172107 96 Well

Nori® Hamster FGFa ELISA Kit

Sign In for Pricing
View Details
Heat Stable Enterotoxin a (STa) BioAssayTM ELISA Kit (General)
589360 96 Tests

Heat Stable Enterotoxin a (STa) BioAssayTM ELISA Kit (General)

Sign In for Pricing
View Details