Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SGCZ Peptide - C-terminal region

SGCZ Peptide - C-terminal region

Product Specifications

Product Name Alternative

ZSG1

UniProt

Q96LD1

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with SGCZ Rabbit Polyclonal Antibody (orb326684) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_631906

Preservative

Lyophilized powder

AA Sequence

EPSQDLRLESPTRSLIMEAPRGVQVSAAAGDFKATCRKELHLQSTEGEIF

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD164/Endolyn Protein (C-His, Human)
P513908 100 µg

CD164/Endolyn Protein (C-His, Human)

Sign In for Pricing
View Details
Human Fibronectin Leucine Rich Transmembrane Protein 3 (FLRT3) ELISA Kit
EKU04203 96 Tests

Human Fibronectin Leucine Rich Transmembrane Protein 3 (FLRT3) ELISA Kit

Sign In for Pricing
View Details
MIR4315-2 ORF Vector (Human) (pORF)
ORF024293 1.0 µg DNA

MIR4315-2 ORF Vector (Human) (pORF)

Sign In for Pricing
View Details
Human CXCL10/IP-10/CRG-2 MAb (Clone 33008R)
MAB2661-SP 25 µg

Human CXCL10/IP-10/CRG-2 MAb (Clone 33008R)

Sign In for Pricing
View Details
Apbb1 Antibody - N-terminal region : HRP (ARP55471_P050-HRP)
ARP55471_P050-HRP 100 µL

Apbb1 Antibody - N-terminal region : HRP (ARP55471_P050-HRP)

Sign In for Pricing
View Details
Luliconazole Impurity 33
RM-L120333-01 10 mg

Luliconazole Impurity 33

Sign In for Pricing
View Details