Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TMPRSS9 Peptide - C-terminal region

TMPRSS9 Peptide - C-terminal region

Product Specifications

UniProt

Q7Z410

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with TMPRSS9 Rabbit Polyclonal Antibody (orb586904) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_892018

Preservative

Lyophilized powder

AA Sequence

PVGRKCMISGWGNTQEGNATKPELLQKASVGIIDQKTCSVLYNFSLTDRM

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ET-3 HDR Plasmid (h)
sc-404436-HDR 20 µg

ET-3 HDR Plasmid (h)

Sign In for Pricing
View Details
Sgk196 ORF Vector (Rat) (pORF)
43628016 1.0 µg DNA

Sgk196 ORF Vector (Rat) (pORF)

Sign In for Pricing
View Details
Cyt19 (F-9) Alexa Fluor® 546
sc-377436 AF546 200 µg/mL

Cyt19 (F-9) Alexa Fluor® 546

Sign In for Pricing
View Details
CD63M Ab Magbeads
E601AB014 ~ 2x 10^9 Cells - 1 mL

CD63M Ab Magbeads

Sign In for Pricing
View Details
Lentiviral mouse Ywhab shRNA (UAS) - Lentiviral mouse Ywhab shRNA (UAS, RFP) (25)
GTR15245159 1 Vial

Lentiviral mouse Ywhab shRNA (UAS) - Lentiviral mouse Ywhab shRNA (UAS, RFP) (25)

Sign In for Pricing
View Details
Arl8b Rat Pre-designed siRNA Set A
HY-RS28920 1 Set

Arl8b Rat Pre-designed siRNA Set A

Sign In for Pricing
View Details