Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TMPRSS9 Peptide - C-terminal region

TMPRSS9 Peptide - C-terminal region

Product Specifications

UniProt

Q7Z410

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with TMPRSS9 Rabbit Polyclonal Antibody (orb586904) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_892018

Preservative

Lyophilized powder

AA Sequence

PVGRKCMISGWGNTQEGNATKPELLQKASVGIIDQKTCSVLYNFSLTDRM

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rat Cytochrome 2E1, CYP 2E1 ELISA KIT
E2477Ra-01 48 Well

Rat Cytochrome 2E1, CYP 2E1 ELISA KIT

Sign In for Pricing
View Details
Rat Cytochrome 2E1, CYP 2E1 ELISA KIT
E2477Ra-02 96 Well

Rat Cytochrome 2E1, CYP 2E1 ELISA KIT

Sign In for Pricing
View Details
Rat Cytochrome 2E1, CYP 2E1 ELISA KIT
E2477Ra-03 5x 96 Tests

Rat Cytochrome 2E1, CYP 2E1 ELISA KIT

Sign In for Pricing
View Details
Rat Cytochrome 2E1, CYP 2E1 ELISA KIT
E2477Ra-04 10x 96 Tests

Rat Cytochrome 2E1, CYP 2E1 ELISA KIT

Sign In for Pricing
View Details
PAFR/PAF Receptor Rabbit Polyclonal Antibody (RBITC)
orb1052013 100 µL

PAFR/PAF Receptor Rabbit Polyclonal Antibody (RBITC)

Sign In for Pricing
View Details
Anti-HOXC12 Antibody Picoband®, Dylight550 Conjugate
A15490-1-Dylight550 100 µg

Anti-HOXC12 Antibody Picoband®, Dylight550 Conjugate

Sign In for Pricing
View Details