Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ANKRD34B Peptide - N-terminal region

ANKRD34B Peptide - N-terminal region

Product Specifications

Product Name Alternative

DP58

UniProt

A5PLL1

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ANKRD34B Rabbit Polyclonal Antibody (orb586925) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001004441

Preservative

Lyophilized powder

AA Sequence

KMVKYLLENNADPNIQDKSGKTALMHACLEKAGPEVVSLLLKSGADLSLQ

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cat Feline IgA Native Protein
117009 100 µg

Cat Feline IgA Native Protein

Sign In for Pricing
View Details
FFAR2 Antibody (Biotin)
orb24183-01 50 µg

FFAR2 Antibody (Biotin)

Sign In for Pricing
View Details
FFAR2 Antibody (Biotin)
orb24183-02 100 µg

FFAR2 Antibody (Biotin)

Sign In for Pricing
View Details
Anti-Arginine Vasopressin Induced Protein 1 (AVPI1) Polyclonal antibody
FY-AB33314-01 1 mL

Anti-Arginine Vasopressin Induced Protein 1 (AVPI1) Polyclonal antibody

Sign In for Pricing
View Details
Anti-Arginine Vasopressin Induced Protein 1 (AVPI1) Polyclonal antibody
FY-AB33314-02 100 µL

Anti-Arginine Vasopressin Induced Protein 1 (AVPI1) Polyclonal antibody

Sign In for Pricing
View Details
Anti-Arginine Vasopressin Induced Protein 1 (AVPI1) Polyclonal antibody
FY-AB33314-03 200 µL

Anti-Arginine Vasopressin Induced Protein 1 (AVPI1) Polyclonal antibody

Sign In for Pricing
View Details