Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ANKRD34B Peptide - N-terminal region

ANKRD34B Peptide - N-terminal region

Product Specifications

Product Name Alternative

DP58

UniProt

A5PLL1

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ANKRD34B Rabbit Polyclonal Antibody (orb586925) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001004441

Preservative

Lyophilized powder

AA Sequence

KMVKYLLENNADPNIQDKSGKTALMHACLEKAGPEVVSLLLKSGADLSLQ

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral human CEP162 sgRNA gene knockout kit - Lentiviral human CEP162 sgRNA gene knockout kit (100)
GTR15389272 1 Vial

Lentiviral human CEP162 sgRNA gene knockout kit - Lentiviral human CEP162 sgRNA gene knockout kit (100)

Sign In for Pricing
View Details
Elisrasib (D3S-001) 50mg
A24548-50 50 mg

Elisrasib (D3S-001) 50mg

Sign In for Pricing
View Details
Recombinant Exoribonuclease 1 (ERI1)
TRV-0052555-01 10 µg

Recombinant Exoribonuclease 1 (ERI1)

Sign In for Pricing
View Details
Recombinant Exoribonuclease 1 (ERI1)
TRV-0052555-02 50 µg

Recombinant Exoribonuclease 1 (ERI1)

Sign In for Pricing
View Details
Recombinant Exoribonuclease 1 (ERI1)
TRV-0052555-03 100 µg

Recombinant Exoribonuclease 1 (ERI1)

Sign In for Pricing
View Details
Recombinant Exoribonuclease 1 (ERI1)
TRV-0052555-04 200 µg

Recombinant Exoribonuclease 1 (ERI1)

Sign In for Pricing
View Details