Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

BPIFB6 Peptide - middle region

BPIFB6 Peptide - middle region

Product Specifications

Product Name Alternative

BPIL3, LPLUNC6

UniProt

Q8NFQ5

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with BPIFB6 Rabbit Polyclonal Antibody (orb326708) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_777557

Preservative

Lyophilized powder

AA Sequence

QLDFSPVVQQQKGKTIKLADAGEALTFPEGYAKGSSQLLLPATFLSAELA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Synaptophysin Antibody
KC-1090-01 50 μL

Synaptophysin Antibody

Sign In for Pricing
View Details
Synaptophysin Antibody
KC-1090-02 100 µL

Synaptophysin Antibody

Sign In for Pricing
View Details
Synaptophysin Antibody
KC-1090-03 1 mL

Synaptophysin Antibody

Sign In for Pricing
View Details
Tissue Total RNA, Ovary: left
CR566320 5 µg

Tissue Total RNA, Ovary: left

Sign In for Pricing
View Details
Maleimido-mono-amide-NOTA TFA Salt (Technical Grade)
TRC-M125010-1MG 1 mg

Maleimido-mono-amide-NOTA TFA Salt (Technical Grade)

Sign In for Pricing
View Details
(Aminocarbonyl)azanyl Carbamic Acid Ester
TRC-A454360-50MG 50 mg

(Aminocarbonyl)azanyl Carbamic Acid Ester

Sign In for Pricing
View Details