Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

BPIFB6 Peptide - middle region

BPIFB6 Peptide - middle region

Product Specifications

Product Name Alternative

BPIL3, LPLUNC6

UniProt

Q8NFQ5

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with BPIFB6 Rabbit Polyclonal Antibody (orb326708) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_777557

Preservative

Lyophilized powder

AA Sequence

QLDFSPVVQQQKGKTIKLADAGEALTFPEGYAKGSSQLLLPATFLSAELA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Chimaerin 2 (CHN2) (NM_001293076) Human Tagged ORF Clone
RG237085 10 µg

Chimaerin 2 (CHN2) (NM_001293076) Human Tagged ORF Clone

Sign In for Pricing
View Details
Human PCDHGB5 activation kit by CRISPRa
GA111099 1 Kit

Human PCDHGB5 activation kit by CRISPRa

Sign In for Pricing
View Details
Tissue FFPE Sections, Thyroid gland
CS705213 5x 5 µm

Tissue FFPE Sections, Thyroid gland

Sign In for Pricing
View Details
Cytokeratin 8 (H1), CF647 conjugate, 0.1mg/mL
BNC470334-100 1x 100 µL

Cytokeratin 8 (H1), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Stpg3 Mouse Gene Knockout Kit (CRISPR)
KN500458 1 Kit

Stpg3 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Mouse Cyp2d10 activation kit by CRISPRa
GA200988 1 Kit

Mouse Cyp2d10 activation kit by CRISPRa

Sign In for Pricing
View Details