Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

BTBD16 Peptide - N-terminal region

BTBD16 Peptide - N-terminal region

Product Specifications

Product Name Alternative

C10orf87

UniProt

Q32M84

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with BTBD16 Rabbit Polyclonal Antibody (orb586932) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_653188

Preservative

Lyophilized powder

AA Sequence

DLLSLSQMCKALSIDFEEALRNPDRLCISQIQKFFFENFKNKDIQSGEAD

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

USP14 Rabbit Monoclonal Antibody [Clone ID: 24GB2190]
TA425313 100 µL

USP14 Rabbit Monoclonal Antibody [Clone ID: 24GB2190]

Sign In for Pricing
View Details
Sulfo-N-succinimidyl (N-Iodoacetyl)aminobenzoate Sodium 90%
TRC-S732000-5MG 5 mg

Sulfo-N-succinimidyl (N-Iodoacetyl)aminobenzoate Sodium 90%

Sign In for Pricing
View Details
Dupilumab Biosimilar - Research Grade
ICH5062-5mg 5 mg

Dupilumab Biosimilar - Research Grade

Sign In for Pricing
View Details
CD3e (Rabbit PAb), CF488A conjugate, 0.1mg/mL
BNC880385-500 1x 500 µL

CD3e (Rabbit PAb), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Human RHBL3 (RHBDL3) activation kit by CRISPRa
GA116050 1 Kit

Human RHBL3 (RHBDL3) activation kit by CRISPRa

Sign In for Pricing
View Details
Recombinant NCX1 Antibody
RC-15140-01 50 μL

Recombinant NCX1 Antibody

Sign In for Pricing
View Details