Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

BTBD16 Peptide - N-terminal region

BTBD16 Peptide - N-terminal region

Product Specifications

Product Name Alternative

C10orf87

UniProt

Q32M84

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with BTBD16 Rabbit Polyclonal Antibody (orb586932) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_653188

Preservative

Lyophilized powder

AA Sequence

DLLSLSQMCKALSIDFEEALRNPDRLCISQIQKFFFENFKNKDIQSGEAD

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Rat CCL5/RANTES Protein (His Tag)
PKSR030422-01 10 µg

Recombinant Rat CCL5/RANTES Protein (His Tag)

Sign In for Pricing
View Details
Recombinant Rat CCL5/RANTES Protein (His Tag)
PKSR030422-02 50 µg

Recombinant Rat CCL5/RANTES Protein (His Tag)

Sign In for Pricing
View Details
Frozen Tissue Sections, Parotid gland
CS641111 5x 5 µm

Frozen Tissue Sections, Parotid gland

Sign In for Pricing
View Details
Cytokeratin 14 (KRT14/532), CF594 conjugate, 0.1mg/mL
BNC940532-500 1x 500 µL

Cytokeratin 14 (KRT14/532), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
HIPK2 Human Gene Knockout Kit (CRISPR)
KN220278BN 1 Kit

HIPK2 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Human IgM Mouse Monoclonal Antibody [4-B2]
M1510-8 100 µL

Human IgM Mouse Monoclonal Antibody [4-B2]

Sign In for Pricing
View Details