Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

BZW2 Peptide - N-terminal region

BZW2 Peptide - N-terminal region

Product Specifications

Product Name Alternative

MST017, MSTP017

UniProt

Q9Y6E2

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with BZW2 Rabbit Polyclonal Antibody (orb331376) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_054757

Preservative

Lyophilized powder

AA Sequence

LDYRRYADTLFDILVAGSMLAPGGTRIDDGDKTKMTNHCVFSANEDHETI

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Ccl6 Polyclonal Antibody
ANT-10636-100ug 100 µg

Ccl6 Polyclonal Antibody

Sign In for Pricing
View Details
Recombinant Streptococcus pneumoniae ATP synthase gamma chain (atpG)
MBS1173899-01 0.02 mg (E-Coli)

Recombinant Streptococcus pneumoniae ATP synthase gamma chain (atpG)

Sign In for Pricing
View Details
Recombinant Streptococcus pneumoniae ATP synthase gamma chain (atpG)
MBS1173899-02 0.02 mg (Yeast)

Recombinant Streptococcus pneumoniae ATP synthase gamma chain (atpG)

Sign In for Pricing
View Details
Recombinant Streptococcus pneumoniae ATP synthase gamma chain (atpG)
MBS1173899-03 0.1 mg (E-Coli)

Recombinant Streptococcus pneumoniae ATP synthase gamma chain (atpG)

Sign In for Pricing
View Details
Recombinant Streptococcus pneumoniae ATP synthase gamma chain (atpG)
MBS1173899-04 0.1 mg (Yeast)

Recombinant Streptococcus pneumoniae ATP synthase gamma chain (atpG)

Sign In for Pricing
View Details
Recombinant Streptococcus pneumoniae ATP synthase gamma chain (atpG)
MBS1173899-05 0.02 mg (Baculovirus)

Recombinant Streptococcus pneumoniae ATP synthase gamma chain (atpG)

Sign In for Pricing
View Details