Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

BZW2 Peptide - N-terminal region

BZW2 Peptide - N-terminal region

Product Specifications

Product Name Alternative

MST017, MSTP017

UniProt

Q9Y6E2

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with BZW2 Rabbit Polyclonal Antibody (orb331376) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_054757

Preservative

Lyophilized powder

AA Sequence

LDYRRYADTLFDILVAGSMLAPGGTRIDDGDKTKMTNHCVFSANEDHETI

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MtTFA HDR Plasmid (h2)
sc-401208-HDR-2 20 µg

MtTFA HDR Plasmid (h2)

Sign In for Pricing
View Details
PRAK Polyclonal Antibody
MBS8524830-01 0.1 mg

PRAK Polyclonal Antibody

Sign In for Pricing
View Details
PRAK Polyclonal Antibody
MBS8524830-02 0.1 mL (AF635)

PRAK Polyclonal Antibody

Sign In for Pricing
View Details
PRAK Polyclonal Antibody
MBS8524830-03 0.1 mL (AF610)

PRAK Polyclonal Antibody

Sign In for Pricing
View Details
PRAK Polyclonal Antibody
MBS8524830-04 0.1 mL (AF405S)

PRAK Polyclonal Antibody

Sign In for Pricing
View Details
PRAK Polyclonal Antibody
MBS8524830-05 0.1 mL (AF405L)

PRAK Polyclonal Antibody

Sign In for Pricing
View Details