SAPCD1 Peptide - C-terminal region
SAPCD1 Peptide - C-terminal region
Product Specifications
Product Name Alternative
C6orf26, NG23
UniProt
Q5SSQ6
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with SAPCD1 Rabbit Polyclonal Antibody (orb586941) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_001034740
Preservative
Lyophilized powder
AA Sequence
NLIHEKFSPSPLNKASSCTTQDSKERRREQNLWQQQELSRQQKGVTQPKE
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
orb2596550 100 µg
Sigma1-receptor/SIGMAR1 Rabbit Polyclonal Antibody (Biotin)
Sign In for Pricing
View Details MBS6160103-01 0.1 mL
S100A5 (Protein S100-A5, Protein S-100D, S100 Calcium-binding Protein A5, S100D) (PE)
Sign In for Pricing
View Details MBS6160103-02 5x 0.1 mL
S100A5 (Protein S100-A5, Protein S-100D, S100 Calcium-binding Protein A5, S100D) (PE)
Sign In for Pricing
View Details 
NBP2-89224-100ul 100 µL
Rabbit Monoclonal Alkaline Phosphatase/ALPL Antibody (071)
Sign In for Pricing
View Details