SAPCD1 Peptide - C-terminal region
SAPCD1 Peptide - C-terminal region
Product Specifications
Product Name Alternative
C6orf26, NG23
UniProt
Q5SSQ6
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with SAPCD1 Rabbit Polyclonal Antibody (orb586941) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_001034740
Preservative
Lyophilized powder
AA Sequence
NLIHEKFSPSPLNKASSCTTQDSKERRREQNLWQQQELSRQQKGVTQPKE
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
MBS6291238-01 0.1 mL
DCTN6, ID (DCTN6, WS3, Dynactin subunit 6, Dynactin subunit p27, Protein WS-3) (MaxLight 405)
Sign In for Pricing
View Details MBS6291238-02 5x 0.1 mL
DCTN6, ID (DCTN6, WS3, Dynactin subunit 6, Dynactin subunit p27, Protein WS-3) (MaxLight 405)
Sign In for Pricing
View Details CTU1-2075M 50 µg
Recombinant Mouse CTU1 Protein, His (Fc)-Avi-tagged
Sign In for Pricing
View Details K2275302 1.0 µg DNA
SPIC sgRNA CRISPR Lentivector (Human) (Target 1)
Sign In for Pricing
View Details 