TOR4A Peptide - C-terminal region
TOR4A Peptide - C-terminal region
Product Specifications
Product Name Alternative
C9orf167
UniProt
Q9NXH8
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with TOR4A Rabbit Polyclonal Antibody (orb326718) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_060193
Preservative
Lyophilized powder
AA Sequence
QYHARHHCPEARAAQDCREELARRVADVVARAEAEEKTPLLVLDDVELMP
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNUM2325-50 1x 50 µL
Annexin A1 / (Hairy Cell Leukemia Marker) (5E4/1), 1mg/mL
Sign In for Pricing
View Details 
GAF-532-15 1 mL
Colloidal Gold Conjugated Rabbit Affinity Purified Antibody to Equine IgG, Fc Specific, 15nm
Sign In for Pricing
View Details 
LY426745 100 µg
HP1 alpha (CBX5) (NM_001127322) Human Over-expression Lysate
Sign In for Pricing
View Details 
BNUM3099-50 1x 50 µL
RNA Polymerase II CTD Repeat YSPTSPS (Phospho S5) (CTD 8A7), 1mg/mL
Sign In for Pricing
View Details